What Should I Say Instead Of As?

What should I say instead of they?

In this page you can discover 23 synonyms, antonyms, idiomatic expressions, and related words for they, like: both, everybody, all, others, those people, people, he and she, men, we, you and he..

What is another way to say I feel?

“The shop assistant encouraged her to feel the superior fabric of the handbag in hopes that she would purchase it.” “He would feel a tap on his shoulder, and it turned out to be his mother who had been looking for him all day.”…What is another word for feel?touchstrokemeddlefiddlegropeliftgripmeddle withplay around withcheck32 more rows

What is another word for would?

Would Synonyms – WordHippo Thesaurus….What is another word for would?couldcanmaymightis able to

What are some good sentence starters?

3. Use Different Words to Order Events and Sequence Timeto be sure… additionally… lastlyeventuallyin the meantimefirst… just in the same way… finallyfinallyfor the time beingbasically… similarly… as well asfirst of allthe next stepafterwardto begin within conclusionat firstin the first placein time4 more rows•Jan 9, 2020

What can I say instead of as?

Synonyms for asat the time that.during the time that.in the act of.in the process of.just as.on the point of.

What to say instead of I would like to?

What is another word for would like?feel likehanker afterwish forcravedesiredislikefancywantwishyen for140 more rows

How do you say I think in other ways?

‘I Think’ Synonyms ListIn my opinion.As far as I’m concerned – This phrase is often used in a more authoritative sense.I believe that…I am of the opinion that…It is my belief…It seems to me/It appears to me.To my way of thinking/In my way of thinking.I honestly think that/ I honestly believe that…More items…•

What is a fancy word for say?

In this page you can discover 97 synonyms, antonyms, idiomatic expressions, and related words for say, like: state, announce, speak, remark, articulate, assert, declare, tell, imply, mention and talk.

What is another way to say greatly appreciated?

What is another word for greatly appreciated?much appreciatedmuch obligedcheersthanksthanks a bunchthanks a lotthanks a millionthanks very muchthank youthank you very much9 more rows

What can I say instead of Id love?

i would love to / synonymsi’d gladly. phr.i’d really love to. phr.i would appreciate. phr.i love this idea. phr.my pleasure. phr.without reluctance. phr.sure. int.i’d appreciate it. phr.More items…

How do you say I like it in different ways?

The different expressions are :I’m into it : when you are interested in an activity. … I’m keen on it : you are interested in something and want to learn more about it. … I’m fond of it : … It appeals to me : … It goes down well : … It’s to my liking : … I’m partial to : … I’m crazy/mad/passionate about :More items…

What is another way to say I am?

In dialogue, one character may say I am, while the next person says I’m instead. We could also consider a general term as we, rather than I, as if including oneself in some group, so as to convince others you’re not somehow distanced from what others or what most people would decide how to act.